<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04933
Description |
Uncharacterized protein |
Sequence | MSRRGYEMEDEEEYMKPMLPTVPDKCGPPVINLGLLIEFAVQQILHELTVLSELLPKKLDADRKISIVQFAHSTRTLFIKLLAVVKWVKSSKKFESCASICYFLDQQAQYFIETADRLAQLSREELVHARLPAFQVPSAIDVLTLGAYPRLPLCIKSRFIRDPSISQREQACVLLRLNQVIQSRLSLVASKLSPKIKSIVIKNGMVNMTVPGEFEVSLTLLGERAITKWTLLNIRILVEDYEIGFGTKLVHPLQVNTIHNVLQLRMDKSEEPLHEVYSMLHSFAQSLQLDVLWCQATRVISAQMRQYALIERYDPKQRVLIISYWLTRTQHNRYTSQYRFKIFSDPLMEHSGLQVRHYPVGKGLPQIDDRTGRLSISRLLSETVSIRCRERLLRLRERLECIKPKTKVYLTGKAAPTLTYPLLGSYSHPDEMLILSINAFSGHILTLLRSLGSRSELRELEQLLADCAPLPTISKLISRLR |
Length | 481 |
Position | Tail |
Organism | Anisakis simplex (Herring worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Ascaridomorpha> Ascaridoidea> Anisakidae> Anisakis>
Anisakis simplex complex.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.066 |
Instability index | 43.99 |
Isoelectric point | 9.40 |
Molecular weight | 55203.12 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU365082
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04933
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.58| 10| 25| 150| 159| 1
---------------------------------------------------------------------------
150- 159 (19.32/14.11) RLPLCIKSRF
176- 185 (17.26/11.76) RLNQVIQSRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.94| 13| 117| 307| 323| 2
---------------------------------------------------------------------------
311- 323 (22.89/ 9.35) ERYDPKQRVLIIS
332- 344 (23.05/ 9.50) NRYTSQYRFKIFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.14| 10| 25| 258| 267| 5
---------------------------------------------------------------------------
258- 267 (18.05/12.02) IHNVLQ.LRMD
280- 290 (13.09/ 6.78) LHSFAQsLQLD
---------------------------------------------------------------------------
|