| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MIPSAGVGGARGVVGMMGQPQGTNPSHVDFLGASVVVLKSISGASYMGGGPNVGSGGVGAASHQPVIPESLLHQSFKNPNWPPNFITAENVLDYFCDPSNVFYDVSSCNQHLKMQNLNRPLHECLQSMQGIQFAVVGANHPLYVIVKQRRNSPTNVTPLCYYYIVNGTVYQCPDLYTFVQSRLIGVVDPLRRALENARQFCRYDVAKGYYWEFKDSSGGGDDENDKKDDSEEEKPLTARSTFFQRTRTEQLLRDLFERFPPPDDVKFEFDGADMASGAGAETSSTADGSSAQRGQGGAAGSGQGNVPVSEGQHHQAMSHQQVAEMSSRGRQGMNTANPASVPTPESSHQRHALGHEASGGPMSFPGQSGSGSSSTVINGSDVKRFKME |
| Length | 388 |
| Position | Head |
| Organism | Anisakis simplex (Herring worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Ascaridomorpha> Ascaridoidea> Anisakidae> Anisakis> Anisakis simplex complex. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.516 |
| Instability index | 46.67 |
| Isoelectric point | 5.95 |
| Molecular weight | 41701.74 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP04932
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 108.64| 24| 54| 289| 312| 1
---------------------------------------------------------------------------
289- 312 (44.50/21.81) SSAQRGQGGAAGSGQGNVPVS.EGQ
326- 344 (27.86/11.07) SS..RGRQGMNTANPASVPTP....
346- 367 (36.27/16.50) SSHQRHALGHEASG.G..PMSfPGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 110.45| 30| 39| 145| 174| 2
---------------------------------------------------------------------------
145- 174 (55.85/39.77) IVKQRRNSPTNVTPLCYYYIVNGTVYQCPD
186- 215 (54.60/38.72) VVDPLRRALENARQFCRYDVAKGYYWEFKD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) NGSDVKRFKME 2) RDLFERF | 378 253 | 388 259 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab