Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MIPSAGVGGARGVVGMMGQPQGTNPSHVDFLGASVVVLKSISGASYMGGGPNVGSGGVGAASHQPVIPESLLHQSFKNPNWPPNFITAENVLDYFCDPSNVFYDVSSCNQHLKMQNLNRPLHECLQSMQGIQFAVVGANHPLYVIVKQRRNSPTNVTPLCYYYIVNGTVYQCPDLYTFVQSRLIGVVDPLRRALENARQFCRYDVAKGYYWEFKDSSGGGDDENDKKDDSEEEKPLTARSTFFQRTRTEQLLRDLFERFPPPDDVKFEFDGADMASGAGAETSSTADGSSAQRGQGGAAGSGQGNVPVSEGQHHQAMSHQQVAEMSSRGRQGMNTANPASVPTPESSHQRHALGHEASGGPMSFPGQSGSGSSSTVINGSDVKRFKME |
Length | 388 |
Position | Head |
Organism | Anisakis simplex (Herring worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Ascaridomorpha> Ascaridoidea> Anisakidae> Anisakis> Anisakis simplex complex. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.516 |
Instability index | 46.67 |
Isoelectric point | 5.95 |
Molecular weight | 41701.74 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04932 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 108.64| 24| 54| 289| 312| 1 --------------------------------------------------------------------------- 289- 312 (44.50/21.81) SSAQRGQGGAAGSGQGNVPVS.EGQ 326- 344 (27.86/11.07) SS..RGRQGMNTANPASVPTP.... 346- 367 (36.27/16.50) SSHQRHALGHEASG.G..PMSfPGQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 110.45| 30| 39| 145| 174| 2 --------------------------------------------------------------------------- 145- 174 (55.85/39.77) IVKQRRNSPTNVTPLCYYYIVNGTVYQCPD 186- 215 (54.60/38.72) VVDPLRRALENARQFCRYDVAKGYYWEFKD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) NGSDVKRFKME 2) RDLFERF | 378 253 | 388 259 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab