<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04930
Description |
Uncharacterized protein |
Sequence | MTSTNMSKVKKSGRSMATKALIIQEYKRRLRDNIKSLNDNFINILQSAKVNVDDAAHRNPVGRMTEYYTLKNEMAARAALMVRAADELLKLTHDLKEFLILHDFNFLSSAIESAEGRADLKMKDYVSKYDNLRLDTASVINDIDKELNEHFSLRQ |
Length | 155 |
Position | Head |
Organism | Anisakis simplex (Herring worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Ascaridomorpha> Ascaridoidea> Anisakidae> Anisakis>
Anisakis simplex complex.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.501 |
Instability index | 40.43 |
Isoelectric point | 9.07 |
Molecular weight | 17797.18 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04930
No repeats found
|