<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04926
| Description |
Guanine nucleotide exchange factor MSS4 (inferred by orthology to a human protein) |
| Sequence | MSSADDGSCAIKNVNTVYNSLVNFISSVEKGTSSDVALRLRQVENSIEQLRESIDSISDISSNEEIQREKIRSLKKQIAAKDSLIASFKNGTASPMSKQKKNIKEVEKETLSEWWSVKKAYDFENIGFTHDASDGIKYLVCADCEVGPVGFLCPETNCHFIACKRVKSMQDGS |
| Length | 173 |
| Position | Middle |
| Organism | Anisakis simplex (Herring worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Ascaridomorpha> Ascaridoidea> Anisakidae> Anisakis>
Anisakis simplex complex.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.436 |
| Instability index | 47.34 |
| Isoelectric point | 5.78 |
| Molecular weight | 19167.41 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | guanyl-nucleotide exchange factor activity GO:0005085 IEA:UniProtKB-KW
transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | protein transport GO:0015031 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
small GTPase mediated signal transduction GO:0007264 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04926
No repeats found
|