<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04925
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MELNSSAVILTFRRRMLSFKNAQESSKFGPFSDQMDPSSGGIASSEQSMLLGSHDLLAEYDMSSAYHRFCGSKKMREDLNSFLPHLVGNFNFDSSLEFRYFDKHADDHLDNGANLDENGDESKRRKKFKRSLDDLDDLDMERKYKRHRGDDKDKRQKKKKKDKKKKKDQKEDDPNKKAKKMF |
| Length | 182 |
| Position | Head |
| Organism | Anisakis simplex (Herring worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Ascaridomorpha> Ascaridoidea> Anisakidae> Anisakis>
Anisakis simplex complex.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -1.335 |
| Instability index | 54.09 |
| Isoelectric point | 9.30 |
| Molecular weight | 21300.68 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04925
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.82| 22| 28| 101| 127| 1
---------------------------------------------------------------------------
91- 116 (29.57/20.45) NFDSSLEFRYFDKHADDhLDngaNLD
118- 139 (39.25/18.99) NGDESKRRKKFKRSLDD.LD...DLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.48| 18| 20| 141| 158| 2
---------------------------------------------------------------------------
141- 158 (32.17/16.57) ERKYKRHRGDDKDKRQKK
163- 180 (30.31/15.20) KKKKKDQKEDDPNKKAKK
---------------------------------------------------------------------------
|