| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MELNSSAVILTFRRRMLSFKNAQESSKFGPFSDQMDPSSGGIASSEQSMLLGSHDLLAEYDMSSAYHRFCGSKKMREDLNSFLPHLVGNFNFDSSLEFRYFDKHADDHLDNGANLDENGDESKRRKKFKRSLDDLDDLDMERKYKRHRGDDKDKRQKKKKKDKKKKKDQKEDDPNKKAKKMF |
| Length | 182 |
| Position | Head |
| Organism | Anisakis simplex (Herring worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Ascaridomorpha> Ascaridoidea> Anisakidae> Anisakis> Anisakis simplex complex. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -1.335 |
| Instability index | 54.09 |
| Isoelectric point | 9.30 |
| Molecular weight | 21300.68 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP04925
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.82| 22| 28| 101| 127| 1
---------------------------------------------------------------------------
91- 116 (29.57/20.45) NFDSSLEFRYFDKHADDhLDngaNLD
118- 139 (39.25/18.99) NGDESKRRKKFKRSLDD.LD...DLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.48| 18| 20| 141| 158| 2
---------------------------------------------------------------------------
141- 158 (32.17/16.57) ERKYKRHRGDDKDKRQKK
163- 180 (30.31/15.20) KKKKKDQKEDDPNKKAKK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EFRYF 2) FKRSLDDLDDLDMERKYKRHRGDDKDKRQKKKKKDKKKKKDQKEDDPNKKAKKMF | 97 128 | 101 182 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab