<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04917

Description Cyclin-dependent kinase 8 (inferred by orthology to a C. elegans protein)
SequenceLLFDYAEHDLWHIIKFHRAAKQKKQPVLVPKGMVKSLLYQILDGIHYLHSNWILHRDLKPANILVMGEGPGVERGRVKIADMGFARIFHNPLKPLAELDPVVVTFWYRAPELLLGAKHYTKAIDIWAIGCIFAELLTSEPVFFCREEDIKASSPYHQDQLNRIFSVMGYPSESDWQDLKKMPEYQKLTQDFKRANYANCTLQKHMDKHKIKADTRSFSLLQRLLTMDPIKRVTAQEAMDDPYFKEDPRPTADVFSGCDIPYPKREFLSDDNDDKSASASKTQQPPPPQQSQQQNIGVHPQQPIMEPAAKKMRMQQNQQMPPTQPQVCKFLCLSIVFLL
Length338
PositionKinase
OrganismAnisakis simplex (Herring worm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Ascaridomorpha> Ascaridoidea> Anisakidae> Anisakis> Anisakis simplex complex.
Aromaticity0.09
Grand average of hydropathy-0.476
Instability index54.09
Isoelectric point8.58
Molecular weight39027.71
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04917
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.04|      14|      16|     227|     242|       1
---------------------------------------------------------------------------
  227-  242 (23.16/23.50)	DPikRVTAQ..EAMDDPY
  246-  261 (23.88/16.00)	DP..RPTADvfSGCDIPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.60|      20|      20|     283|     302|       2
---------------------------------------------------------------------------
  283-  302 (40.21/23.12)	QPPPPQQSQQQNIGVHPQQP
  305-  324 (38.39/21.76)	EPAAKKMRMQQNQQMPPTQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.48|      21|      26|     147|     169|       3
---------------------------------------------------------------------------
  147-  169 (28.64/24.16)	EDIKASSPYhQdQLNRIFSVMGY
  176-  196 (37.84/21.21)	QDLKKMPEY.Q.KLTQDFKRANY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04917 with CDK8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) REFLSDDNDDKSASASKTQQPPPPQQSQQQNIGVHPQQPIMEPAAKKMRMQQNQQMPPT
264
322










Molecular Recognition Features






MoRF SequenceStartStop




NANANA