<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04917
| Description |
Cyclin-dependent kinase 8 (inferred by orthology to a C. elegans protein) |
| Sequence | LLFDYAEHDLWHIIKFHRAAKQKKQPVLVPKGMVKSLLYQILDGIHYLHSNWILHRDLKPANILVMGEGPGVERGRVKIADMGFARIFHNPLKPLAELDPVVVTFWYRAPELLLGAKHYTKAIDIWAIGCIFAELLTSEPVFFCREEDIKASSPYHQDQLNRIFSVMGYPSESDWQDLKKMPEYQKLTQDFKRANYANCTLQKHMDKHKIKADTRSFSLLQRLLTMDPIKRVTAQEAMDDPYFKEDPRPTADVFSGCDIPYPKREFLSDDNDDKSASASKTQQPPPPQQSQQQNIGVHPQQPIMEPAAKKMRMQQNQQMPPTQPQVCKFLCLSIVFLL |
| Length | 338 |
| Position | Kinase |
| Organism | Anisakis simplex (Herring worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Ascaridomorpha> Ascaridoidea> Anisakidae> Anisakis>
Anisakis simplex complex.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.476 |
| Instability index | 54.09 |
| Isoelectric point | 8.58 |
| Molecular weight | 39027.71 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04917
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.04| 14| 16| 227| 242| 1
---------------------------------------------------------------------------
227- 242 (23.16/23.50) DPikRVTAQ..EAMDDPY
246- 261 (23.88/16.00) DP..RPTADvfSGCDIPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.60| 20| 20| 283| 302| 2
---------------------------------------------------------------------------
283- 302 (40.21/23.12) QPPPPQQSQQQNIGVHPQQP
305- 324 (38.39/21.76) EPAAKKMRMQQNQQMPPTQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.48| 21| 26| 147| 169| 3
---------------------------------------------------------------------------
147- 169 (28.64/24.16) EDIKASSPYhQdQLNRIFSVMGY
176- 196 (37.84/21.21) QDLKKMPEY.Q.KLTQDFKRANY
---------------------------------------------------------------------------
|