Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MQGIQFAVVGANHPLYVIVKQRRNSPTNGREMHGTRSAPHPSSIPTSSTFMQSMQGIQFAVVGANHPLYVIVKQRRNSPTNVLKNNLKSMQGIQFAVVGANHPLYVIVKQRRNSPTNVTPLCYYYVVNGTVYQCPDIYTFVQSKLIGAVDPLRRALEQARQFSRYNVAKGYYWEFKEPTAESEKKEKKEEEKPLTARSTFFQRTRTEQLLRDLFEKFPPPDDVKFEFDSGEVASGETSAADRSDAPSRIGQETGGSMPPEGQQQQTGGTSRQNVTGPASVPPLQTHQNGGAHETGGPMSFPGPAMNGHHENGDVKRFKME |
Length | 320 |
Position | Head |
Organism | Ascaris lumbricoides (Giant roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Ascaridomorpha> Ascaridoidea> Ascarididae> Ascaris. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.711 |
Instability index | 47.18 |
Isoelectric point | 9.39 |
Molecular weight | 35570.55 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04911 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 238.93| 32| 35| 51| 82| 1 --------------------------------------------------------------------------- 1- 29 (60.42/36.41) ...MQGIQFAVVGANHPLYVIVKQRRN.SPTNG 51- 82 (71.91/44.51) MQSMQGIQFAVVGANHPLYVIVKQRRN.SPTNV 87- 118 (70.15/43.27) LKSMQGIQFAVVGANHPLYVIVKQRRN.SPTNV 141- 167 (36.44/19.49) VQS......KLIGAVDPLRRALEQARQfSRYNV --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.64| 20| 20| 276| 295| 2 --------------------------------------------------------------------------- 256- 278 (28.80/13.61) SMPPEgQQQQTGGTsrQNVTGPA 279- 298 (40.85/22.09) SVPPL.QTHQNGGA..HETGGPM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) VKRFKME 2) YYWEFK | 314 171 | 320 176 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab