<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04910
| Description |
Uncharacterized protein |
| Sequence | MELRVSSLAAPRVTAPTTTPALSLLRQPTASAAGILRGTGRGSSLMTPPFSAMQQQQRSWSPRGNFVGQSSSPRGRGSRGGLISPRMSAGASSLLQRRQSGTSPRVSSPSSAYSMGGKGMPPPVKNIEQMSSDSSSSSSSDEGSPS |
| Length | 146 |
| Position | Middle |
| Organism | Ascaris lumbricoides (Giant roundworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Ascaridomorpha> Ascaridoidea> Ascarididae> Ascaris.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.560 |
| Instability index | 94.90 |
| Isoelectric point | 12.00 |
| Molecular weight | 14996.59 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04910
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 132.06| 30| 34| 48| 81| 1
---------------------------------------------------------------------------
20- 44 (33.66/ 8.01) PALSL.....LRQPTASAAGilRGT.........GRGS..S
48- 81 (52.58/22.58) PPFSA.....MQQQQRSWSP..RGNfVgqsSSPRGRGSRGG
85- 117 (45.82/12.85) PRMSAgasslLQRRQSGTSP..R...V...SSPSSAYSMGG
---------------------------------------------------------------------------
|