Description | Uncharacterized protein |
Sequence | MELRVSSLAAPRVTAPTTTPALSLLRQPTASAAGILRGTGRGSSLMTPPFSAMQQQQRSWSPRGNFVGQSSSPRGRGSRGGLISPRMSAGASSLLQRRQSGTSPRVSSPSSAYSMGGKGMPPPVKNIEQMSSDSSSSSSSDEGSPS |
Length | 146 |
Position | Middle |
Organism | Ascaris lumbricoides (Giant roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Ascaridomorpha> Ascaridoidea> Ascarididae> Ascaris. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.560 |
Instability index | 94.90 |
Isoelectric point | 12.00 |
Molecular weight | 14996.59 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP04910 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 132.06| 30| 34| 48| 81| 1 --------------------------------------------------------------------------- 20- 44 (33.66/ 8.01) PALSL.....LRQPTASAAGilRGT.........GRGS..S 48- 81 (52.58/22.58) PPFSA.....MQQQQRSWSP..RGNfVgqsSSPRGRGSRGG 85- 117 (45.82/12.85) PRMSAgasslLQRRQSGTSP..R...V...SSPSSAYSMGG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GMPPPVKNI 2) LMTPPFS 3) RGSRGGLISPRMSAGASSLLQ 4) SWSPRGNFV | 119 45 76 59 | 127 51 96 67 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab