Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSATTSASGSGMAGSELLRRLSAISEIDQRIGDLMKHAQTCIAELSKEKQISKSKMEEASSAFKRTLNAIESELSAQMQYLSHVCVGTPHQGSTFASQQNVTLAEETILALSDRLMRIQSEHVPSTSDDIPMG |
Length | 133 |
Position | Head |
Organism | Ascaris lumbricoides (Giant roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Ascaridomorpha> Ascaridoidea> Ascarididae> Ascaris. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.297 |
Instability index | 49.18 |
Isoelectric point | 5.51 |
Molecular weight | 14358.07 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04896 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 113.98| 39| 45| 1| 42| 1 --------------------------------------------------------------------------- 1- 42 (57.58/39.98) MSATTSASGSGM..AGSELLRRLSAI.SEIDQRIgDLMKHaqTCI 45- 86 (56.39/29.94) LSKEKQISKSKMeeASSAFKRTLNAIeSELSAQM.QYLSH..VCV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ELLRRLSAI 2) FASQQNV 3) ISKSKME 4) SSAFKRTLNAIESELSAQ | 16 95 51 60 | 24 101 57 77 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab