<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04876
Description |
Uncharacterized protein |
Sequence | MSRRPGNPSRRFGDNGGGLFSSKSRSPPVLSIALVVMGGLFVIGYFYRGSGGLGSRLDSVSRLEGDYLCSGEVQQAIPILQKAYGDSMHKVLHVGPDSCYVVSKLLKEEETEAWGIEPYDIEEADSSCKALIHRGSVRVADIKFPLPYRPKSFSLVIVSDALDYLSPRYLNKTLPDLVRVASDGVVIFTGFPTTQKAKVADVSKFGRAAKMRSSSWWVKFFLQINLEENEAASKKFEQASTKSSPSLKSQYASAQMPPIQPLRLLVPANYPNCSPNTNFQLNPAKLTVGDSGNLKGSPITLNRVARFAGPLNGVLPNRSSYRNIPNVHQSTTLRCPSPLMIFGAKSSCVPTKDIDLAFVGSAISSGRGVTWLCTSFFGLDFLSFLDFLDRKRSVKHAV |
Length | 398 |
Position | Tail |
Organism | Phaseolus angularis (Azuki bean) (Vigna angularis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.141 |
Instability index | 56.85 |
Isoelectric point | 9.55 |
Molecular weight | 43472.38 |
Publications | PubMed=26460024
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | methyltransferase activity GO:0008168 IEA:InterPro
|
GO - Biological Process | pectin metabolic process GO:0045488 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04876
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.08| 17| 17| 50| 66| 6
---------------------------------------------------------------------------
50- 66 (27.55/19.18) SGGLGSRLDSVSRLEGD
70- 86 (28.53/20.13) SGEVQQAIPILQKAYGD
---------------------------------------------------------------------------
|