<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04873
Description |
Uncharacterized protein |
Sequence | MAPPRGRGGGGGFRGGRGDRGRGRGGGGRGGDRGTPFKARGGGRGGGRGGGRGGGRGGGRGGMKGGSKVVVQPHRHEGIFIAKGKEDALVTKNLVPGEAVYNEKRVTVQNEDGSKDEYRIWNPFRSKLAAAILGGVDNIWIKPGARVLYLGAASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILGLNASYYLKAGGHFVISIKANCIDSTVPAEAVFESEVNKLKADQFKPFEQVTLEPFERDHACVVGGYRLPKKKKDTAA |
Length | 308 |
Position | Unknown |
Organism | Phaseolus angularis (Azuki bean) (Vigna angularis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.442 |
Instability index | 28.36 |
Isoelectric point | 10.10 |
Molecular weight | 32630.75 |
Publications | PubMed=26460024
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | methyltransferase activity GO:0008168 IEA:UniProtKB-KW
RNA binding GO:0003723 IEA:UniProtKB-KW
|
GO - Biological Process | methylation GO:0032259 IEA:UniProtKB-KW
rRNA processing GO:0006364 IEA:UniProtKB-KW
|
Interaction
Repeat regions
Repeats |
>MDP04873
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.74| 15| 16| 20| 34| 1
---------------------------------------------------------------------------
20- 34 (35.59/11.51) RGRGRG.GGGRGGDRG
38- 53 (29.16/ 8.20) KARGGGrGGGRGGGRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.03| 17| 18| 188| 204| 3
---------------------------------------------------------------------------
168- 191 (20.30/12.91) TGVVYAVEfshrsgrDLVNMAKKR
192- 208 (30.72/23.03) TNVIPIIE.......DARHPAKYR
---------------------------------------------------------------------------
|