<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04866
Description |
Uncharacterized protein |
Sequence | MDSNNWRPNQGNNPTMDTNDWRAQLPPGSRQKIVNKIMDTLKKDNPFSGPDGLQELRQIAIRFEEEIFTTARSQPDYLRKISMKMLTWETKSQNTLANSQVGPSNRPTDQG |
Length | 111 |
Position | Tail |
Organism | Phaseolus angularis (Azuki bean) (Vigna angularis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -1.128 |
Instability index | 43.28 |
Isoelectric point | 9.15 |
Molecular weight | 12735.09 |
Publications | PubMed=26460024
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP04866
No repeats found
No repeats found
|