Description | Uncharacterized protein |
Sequence | MDSVVDSLNNAYQDFVSAAANVLEAKENAGSVKTTATDTALENFKQKWELFRVACDQAEEFVESVKQRIGSECLVDEATRPVAGKPGQATMTGLPPISAVRLEQMSKAVRWLVIELQHGSGASSANSALSHPSAPFDARFSEDATQ |
Length | 146 |
Position | Tail |
Organism | Phaseolus angularis (Azuki bean) (Vigna angularis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.284 |
Instability index | 49.09 |
Isoelectric point | 4.78 |
Molecular weight | 15674.27 |
Publications | PubMed=26460024 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04861 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) GLPPISAVRLEQ 2) PFDARFSEDATQ | 93 135 | 104 146 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab