<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04848
| Description |
Uncharacterized protein |
| Sequence | MDLDDFRSILDTSGVDVWMFIDAAIAVASADCAAELKRRRDSIVESLYSATAAPPQCRNCGDGHRLRPNGHQVAKQNSPSPSPERQPQRRAAAATANSPATPQSLENDDGGEELDPYGGLFDDEQKKILDIKEQLEEPDQSEDSLVELLQSLADMDITFQALKETDIGRHVNRLRKHPSNDVRRLVKLLVRKWKEIVDEWVKLNPQGGSNTLMADGDSPVQKTTQNGHHHQIPDFAYSPNPHNGSSGSDRNNSEAEHKPKVIPRSEARPKPTPAPSVSTPASASQNRQRQSSFDAERLASARRRLQENYKEAENAKRQRTIQVMDINELPKSKPKNAFFGKNKGGGGSQGRHW |
| Length | 353 |
| Position | Unknown |
| Organism | Phaseolus angularis (Azuki bean) (Vigna angularis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.986 |
| Instability index | 62.32 |
| Isoelectric point | 6.81 |
| Molecular weight | 39185.91 |
| Publications | PubMed=26460024
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04848
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.46| 21| 45| 50| 70| 1
---------------------------------------------------------------------------
50- 70 (44.34/28.17) ATA...APPQCRNCGD.GHRLRPNG
94- 118 (30.12/16.88) ATAnspATPQSLENDDgGEELDPYG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.43| 21| 28| 228| 248| 3
---------------------------------------------------------------------------
228- 248 (43.17/25.17) HHHQ.IPDFAYSPNPHNGSSGS
257- 278 (33.26/17.74) HKPKvIPRSEARPKPTPAPSVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.94| 11| 14| 283| 293| 6
---------------------------------------------------------------------------
283- 293 (19.17/10.83) ASQNRQRQSSF
299- 309 (18.77/10.49) ASARRRLQENY
---------------------------------------------------------------------------
|