<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04824
| Description |
Uncharacterized protein |
| Sequence | MLTKKFIEADPIDVTLSLKDRPRELTGAVDLISHFKLLPHYEFFCKRPLPVPIADTHYLHNVVGDTEIRKGDGMQLDQLIQYTSSFRDTNARIQPFDLDVLKEAFQLRETAPVDLPAAEKGIPTISGKSKSENKDKEKKHKKHKDKDKDKDKDKDKEHKKHKHRHKDRSKDKDKDKDRDKKKDKSGHRDSSADHSKKHHEKKRKHDGDDDVNDVHKHKRSKHKSSKIDELGAIKVAG |
| Length | 237 |
| Position | Head |
| Organism | Phaseolus angularis (Azuki bean) (Vigna angularis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.402 |
| Instability index | 32.28 |
| Isoelectric point | 9.47 |
| Molecular weight | 27443.71 |
| Publications | PubMed=26460024
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04824
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 95.09| 19| 19| 135| 153| 1
---------------------------------------------------------------------------
135- 153 (38.36/12.52) DKE.KKH.K.KHKDKDKDKDKD
155- 175 (29.40/ 8.10) DKEhKKH.KhRHKDRSKDKDKD
189- 208 (27.33/ 7.07) DSS.ADHsK.KHHEKKRKHDGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.68| 15| 20| 80| 98| 2
---------------------------------------------------------------------------
80- 98 (21.62/23.67) IQYTSSFRDTnariQPFDL
101- 115 (24.06/15.36) LKEAFQLRET....APVDL
---------------------------------------------------------------------------
|