Description | Uncharacterized protein |
Sequence | MDIISQLQEQVNLIAHLAFNTIGTLQRDAPPNRLSPNYPEPPAHPTEEGTNFSEQPKLMSSTLVKAAKQFDALVAALPISESGEEAQLKRITELQAENDAIGQELQKQLEAAEKELNQVQELFRQASDNCLNLKKPDDN |
Length | 139 |
Position | Middle |
Organism | Phaseolus angularis (Azuki bean) (Vigna angularis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.638 |
Instability index | 56.73 |
Isoelectric point | 4.58 |
Molecular weight | 15418.05 |
Publications | PubMed=26460024 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule polar nucleus GO:0043078 IEA:EnsemblPlants |
GO - Biological Function | |
GO - Biological Process | defense response to fungus GO:0050832 IEA:EnsemblPlants |
Binary Interactions |
Repeats | >MDP04819 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.22| 13| 16| 95| 108| 1 --------------------------------------------------------------------------- 95- 108 (17.36/17.24) QAENDAIgQELQKQ 113- 125 (20.86/13.88) EKELNQV.QELFRQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEAQLKRITELQAENDAIG 2) FSEQPKLMSSTLVKAAKQFDALVAALPI | 84 52 | 102 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab