<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04815
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATATYPPPPPFYRLYKDYLQDPKSAPEPPPPIEGTYVCFGGNYTTSDVLPSLEEQGVRQLYSKGPNVDFKKELRSLNGELQLHVLELADILIERPSQYARRVEEISTVFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKSEHKLDRREMFKWGSEL |
| Length | 165 |
| Position | Middle |
| Organism | Phaseolus angularis (Azuki bean) (Vigna angularis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.637 |
| Instability index | 70.63 |
| Isoelectric point | 7.02 |
| Molecular weight | 19133.63 |
| Publications | PubMed=26460024
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04815
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.65| 10| 19| 7| 16| 1
---------------------------------------------------------------------------
7- 16 (24.43/10.71) P.PPPPFYRLY
27- 37 (19.23/ 7.31) PePPPPIEGTY
---------------------------------------------------------------------------
|