<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04808
Description |
Uncharacterized protein |
Sequence | MAGNFWQSSHYQQWLLDRQDILRERQADLKVLSEDEYQKIMVFYSNFIQALGEQLKMRQQVIASATVYFKRFYARNSLRSIDPWLMAPTCIFLASKVEEFGVISNNKLMTTCQNVVKTKFSHAYTQEYPYRINSVLECEFYLLEMMDCCLVLYHPYRPLIQYCADLGQDDNLLPVAWRIVNDSLRTDVCLMYPPYLIALACLHIACVIQDKDGRQWFAELSVDMDKVLEITKQILAFYELWKNYEEKKEIIAVLVKMPKPKTSPTRNEAKMQQ |
Length | 273 |
Position | Kinase |
Organism | Octopus bimaculoides (California two-spotted octopus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Cephalopoda>
Coleoidea> Octopodiformes> Octopoda> Incirrata> Octopodidae> Octopus.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.182 |
Instability index | 54.65 |
Isoelectric point | 6.45 |
Molecular weight | 32199.12 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04808
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.42| 19| 109| 76| 94| 2
---------------------------------------------------------------------------
76- 94 (37.43/25.20) NSLRS.....IDPWLMAPTCIFLA
182- 205 (29.99/18.88) DSLRTdvclmYPPYLIALACLHIA
---------------------------------------------------------------------------
|