<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04788
Description |
Uncharacterized protein |
Sequence | MIATDTQQMLFPTVSDVVFVIESTANLAAHKDILKTSYIQPTLEYFNGGPPDPTDYGCDVS |
Length | 61 |
Position | Unknown |
Organism | Octopus bimaculoides (California two-spotted octopus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Cephalopoda>
Coleoidea> Octopodiformes> Octopoda> Incirrata> Octopodidae> Octopus.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.026 |
Instability index | 33.47 |
Isoelectric point | 4.05 |
Molecular weight | 6667.41 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP04788
No repeats found
No repeats found
|