<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04788
| Description |
Uncharacterized protein |
| Sequence | MIATDTQQMLFPTVSDVVFVIESTANLAAHKDILKTSYIQPTLEYFNGGPPDPTDYGCDVS |
| Length | 61 |
| Position | Unknown |
| Organism | Octopus bimaculoides (California two-spotted octopus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Cephalopoda>
Coleoidea> Octopodiformes> Octopoda> Incirrata> Octopodidae> Octopus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.026 |
| Instability index | 33.47 |
| Isoelectric point | 4.05 |
| Molecular weight | 6667.41 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04788
No repeats found
No repeats found
|