<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04783
| Description |
Uncharacterized protein (Fragment) |
| Sequence | TDLCGIKWRKLNADNVSVDPLDDPVLDSYTRCIQSDILCVWRRVLRNSEQRLPDQLAYGKELWIFWYGDKPLSLDTLLSPSLK |
| Length | 83 |
| Position | Middle |
| Organism | Octopus bimaculoides (California two-spotted octopus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Cephalopoda>
Coleoidea> Octopodiformes> Octopoda> Incirrata> Octopodidae> Octopus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.335 |
| Instability index | 33.70 |
| Isoelectric point | 5.18 |
| Molecular weight | 9666.98 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04783
No repeats found
No repeats found
|