<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04774

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMFYYGSKKGKQTASDAVNQGIPPQGIPPQSLAPGQSPQQAQQQSQTMQDPINALQNLAMQGTTSAICPQQAGMMNHQQATAAHIQYQQRHMPARTPVNQPKPVPLQRHDAFMVSQAPPQAQQQAQPPTTSQQPVPPPQTSTQQQPQQQQSAPQQQMVGQQMAVSGPNQLPFQGGNPPSVPRSMVQSPYMSPQQYGQSPSQVQPASNVSQLNTAHSPATQGSHMVHSPANLAAPSPNTHIVPSPVSRNAAMGAPSPGSALNTPGNPGSVGTTASPSEDQAYLEKLKQLSKFIDPLRRMIRKTETEEDNKKDQSHKMKNLLEILSDPSKRLPMTTLLKCEQVLLKMELSKPPSSSDGSGSSSKNGEQHMCQPLLDSIAAHMKSPMLNHTLHRTFGPAVAALRGQPIRVPSPPPTKKPKVSNEKDKLSNILQGEIARLPHRFRISLDPAHHVSSKTVHLICKLDDKNLPSVPPILIVVPEDYPSTSPQCDSNAEDYTATPFLQGVQNALQSSLQKMPDHFSVATLLDTWEMSVRRMCAPTS
Length538
PositionTail
OrganismOctopus bimaculoides (California two-spotted octopus)
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Cephalopoda> Coleoidea> Octopodiformes> Octopoda> Incirrata> Octopodidae> Octopus.
Aromaticity0.03
Grand average of hydropathy-0.694
Instability index80.88
Isoelectric point9.31
Molecular weight58310.38
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04774
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     156.96|      28|      30|     118|     145|       1
---------------------------------------------------------------------------
   16-   39 (39.39/11.58)	AVNQGIP...P.....QGIPPQSLAP...GQSPQQ
   86-  119 (32.13/ 7.93)	YQQRHMPartPVNQ.PKPVPLQRHDAfmvSQAPPQ
  120-  147 (53.06/18.46)	AQQQAQP...PTTS.QQPVPPPQTST...QQQPQQ
  248-  276 (32.39/ 8.06)	AAMGAPS...PGSAlNTPGNPGSVGT...TASPSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     182.25|      41|     151|      42|      82|       2
---------------------------------------------------------------------------
   42-   82 (70.50/26.64)	QQSQTMQD......PINALQNLAMQGTTSAICPQ...QAGMMNHQQATAA
  148-  193 (50.72/17.09)	QQSAPQQQmvgqqmAVSGPNQLPFQGGNPPSVPRsmvQSPYMSPQQ....
  195-  231 (61.03/22.07)	GQSPSQVQ......PASNVSQLNTAHSPAT.......QGSHMVHSPANLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     145.38|      44|      68|     372|     422|       3
---------------------------------------------------------------------------
  372-  417 (68.01/31.77)	LDSiAAHMKSPMLnHTLHRTFGPAVAALRGQPIRVPSPPPTKKPKV
  443-  486 (77.37/31.98)	LDP.AHHVSSKTV.HLICKLDDKNLPSVPPILIVVPEDYPSTSPQC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      64.38|      21|      30|     277|     297|       4
---------------------------------------------------------------------------
  277-  291 (17.83/ 8.67)	..................DQAYLEKLKQLSKFI
  292-  322 (24.40/14.70)	DPLRRMirkteteednkkDQSH..KMKNLLEIL
  324-  339 (22.15/12.63)	DPSKRL............PMTTLLKCEQ.....
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04774 with Med15 domain of Kingdom Metazoa
Unable to open file!