Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MMADQLRRVEPAISSPKSSPRGSRSPAHPRTDSTGTLKTTISLGKVPSVIHSGPFYLMKDVPEQAEMTGYTNLMSYYGLGNSYNKFFTKKVKEELSAFLPTLPGNIDTPGINDTSSLRSVIEKPPISTRELLPLSGASLAGFRLHPGPLPEQYRFLNQTPQKKKHKHKKSKKEGGKDGNSQEIQGENSSDTGHDKKKKVKRSDEEKEKKKRKKKKKKKHSPEHPLSVPSSSDITL |
Length | 235 |
Position | Head |
Organism | Octopus bimaculoides (California two-spotted octopus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Cephalopoda> Coleoidea> Octopodiformes> Octopoda> Incirrata> Octopodidae> Octopus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.040 |
Instability index | 55.63 |
Isoelectric point | 9.95 |
Molecular weight | 26116.50 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04756 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 91.69| 30| 43| 161| 190| 1 --------------------------------------------------------------------------- 161- 190 (52.72/27.34) QKKK......HKHKKSKKEGGKDGNSQE..IQGENSSD 195- 232 (38.96/18.38) KKKKvkrsdeEKEKKKRKKKKKKKHSPEhpLSVPSSSD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HDKKKKVKRSDEEKEKKKRKKKKKKKHSPEHP 2) RFLNQ | 193 154 | 224 158 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab