<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04752
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MFDGIFPSMASSRVPVHPSQETDEQQKLRFQVEMEFVQCLANPNYLNFLAQRNYFKDPSFVNYLKYLQYWKEAKYAKYLKYPQCLHFLELLQYEHFRKELVNLQCAKFIDDQQLLHWQHYQRKRMALLQAQSELATSQQQQQQQQQQLQQTGATGGGPGGVGIQSVQGGGVGAGVTTGSQPQQMGGAAAVSCQPTLTTQTGSLQQITQKDK |
| Length | 211 |
| Position | Middle |
| Organism | Octopus bimaculoides (California two-spotted octopus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Cephalopoda>
Coleoidea> Octopodiformes> Octopoda> Incirrata> Octopodidae> Octopus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.626 |
| Instability index | 54.39 |
| Isoelectric point | 8.61 |
| Molecular weight | 23957.78 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04752
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.69| 20| 22| 83| 104| 1
---------------------------------------------------------------------------
83- 102 (38.72/14.80) QCLHFLE...LLQYEHF.RKELVN
104- 127 (25.97/10.15) QCAKFIDdqqLLHWQHYqRKRMAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.50| 12| 15| 162| 173| 2
---------------------------------------------------------------------------
162- 173 (22.04/13.31) GIQSVQGGGVGA
178- 189 (22.46/13.72) GSQPQQMGGAAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.60| 15| 17| 44| 60| 3
---------------------------------------------------------------------------
44- 58 (29.60/20.32) NYLNFLAQ......RNYFKDP
62- 82 (23.00/ 8.31) NYLKYLQYwkeakyAKYLKYP
---------------------------------------------------------------------------
|