<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04751
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MVDGGSPFTTPSPGTRNWLGSPSAQGPSPVSRHGTATSPGHPALHSPQTQVKDSEHSKSSVVSPAPRMLPQRSWAASIPTILSHEAFSKLLTPCPLPGMNFLPASPLERFLGCVYFRRHLPRVIQGESSV |
| Length | 130 |
| Position | Tail |
| Organism | Octopus bimaculoides (California two-spotted octopus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Cephalopoda>
Coleoidea> Octopodiformes> Octopoda> Incirrata> Octopodidae> Octopus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.335 |
| Instability index | 71.73 |
| Isoelectric point | 10.04 |
| Molecular weight | 13873.63 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04751
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.07| 21| 24| 4| 25| 1
---------------------------------------------------------------------------
4- 25 (39.70/19.06) GGSPF....TTPSPGtRNWLGSPSAQ
26- 50 (37.37/14.47) GPSPVsrhgTATSPG.HPALHSPQTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.73| 19| 26| 59| 79| 2
---------------------------------------------------------------------------
59- 79 (29.95/23.57) SSVVSPAPrmLPQRSWAASIP
88- 106 (36.78/21.89) SKLLTPCP..LPGMNFLPASP
---------------------------------------------------------------------------
|