<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04742
Description |
Mediator of RNA polymerase II transcription subunit 28 |
Sequence | MATPTNGNGNLIDEFEEAFQQCLSILITKDEGLGNTGIGVSGGLTVDKEEARSEVEQVTLRFIDLARQMEAFFLQKRFLLSALKPELVVKEDINDLRVELARKEDLIKRHYDKITVWQNLLADLQGWAKSPAQGPAPNGKDHIISQNESILYNLKLP |
Length | 157 |
Position | Head |
Organism | Habropoda laboriosa |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Apoidea> Apidae>
Habropoda.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.324 |
Instability index | 44.62 |
Isoelectric point | 4.99 |
Molecular weight | 17604.86 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP04742
No repeats found
No repeats found
|