<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04739
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MADRLTQLQDTINQQAEHFCNSVGILQQYSTPSKFPGFDRVGTPQPHQPQEDYAALFATLIARCAKDIDTLIESLPSEESSQELQVASLNRLEKENQEAGEQLEEVVKQGEALLQRIQAALQDIAQSQLDMQDPASTSVINIDLNTNSTFKQENVNSVNTVSSNSTHQLSDPSPNSVNQ |
| Length | 179 |
| Position | Middle |
| Organism | Habropoda laboriosa |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Apoidea> Apidae>
Habropoda.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.625 |
| Instability index | 57.27 |
| Isoelectric point | 4.32 |
| Molecular weight | 19740.38 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04739
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.54| 18| 18| 142| 159| 1
---------------------------------------------------------------------------
142- 159 (29.64/16.18) IDLNTNSTFKQENVNSVN
161- 178 (30.90/17.12) VSSNSTHQLSDPSPNSVN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.79| 18| 23| 87| 104| 2
---------------------------------------------------------------------------
87- 104 (29.26/21.01) ASLNRLEKENQE.AGEQLE
112- 130 (24.53/16.40) ALLQRIQAALQDiAQSQLD
---------------------------------------------------------------------------
|