<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04731
| Description |
Cyclin-C |
| Sequence | MAGNFWQSSHHQQWLLDKQDLVRERQHDLSIFTEEEYQKLFIFFSNLIQVLGEQLKLRQQVIATATVYFKRFYARNSLKCIDPLLLAPTSVFLASKVEEFGVISHNRLIAACQTVVKNKFNYAYSQEFPYRGSHISECEFYLLEHLDCCLIVYQPYRPLLTLIQDVGPDEQLLTLAWRIINDSLRTDVCLLYPPYQIAIGCLQIACVILQKDLKSWFAELNADMEKIQEIARYIINLYELWKTYDEKKEIQGLLSKMPKPTPSPPQH |
| Length | 267 |
| Position | Kinase |
| Organism | Habropoda laboriosa |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Apoidea> Apidae>
Habropoda.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.130 |
| Instability index | 52.87 |
| Isoelectric point | 6.18 |
| Molecular weight | 31300.90 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04731
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 23.27| 7| 26| 104| 113| 2
---------------------------------------------------------------------------
104- 113 ( 8.98/14.93) SHnrlIAACQ
133- 139 (14.29/ 9.14) SH...ISECE
---------------------------------------------------------------------------
|