<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04723
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MYKISSIYTNKMQKMESKGPRFEIGDFCVKLGSVTINQNFKGVLVEVEYRPCVVPGSAWELMREFLQGFLGSTVSNQAPQYLQKFTFRLFVVKPATTIREIKEELYKLRKAPYIHRQSLRLNPKGKALSDSDTLQSLSISDGGKLYYKDLGPQISWKTVFLVEYAGPLFLYIWIYQRPWIFYGDAGASKIHNVVHTAAVCWGVHYAKRLLETLFVHRFSHATMPLRNLFKNCSYYWLFAMYVAYHVNHPLYTAPSQCQYLVGLATFALCEVGNLSIHIALRNLRPPGSTVRKIPVPTSNPFTALFNLVSCPNYTYEVGSWIGFTIMTSCLPAGLFTFAGAYQMTIWALGKHKAYKKEFSQYPKCRKAIVPFVL |
Length | 373 |
Position | Head |
Organism | Habropoda laboriosa |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Apoidea> Apidae>
Habropoda.
|
Aromaticity | 0.15 |
Grand average of hydropathy | 0.011 |
Instability index | 38.54 |
Isoelectric point | 9.58 |
Molecular weight | 42644.37 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | endoplasmic reticulum membrane GO:0005789 IEA:UniProtKB-SubCell
integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | oxidoreductase activity, acting on the CH-CH group of donors GO:0016627 IEA:InterPro
transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | lipid metabolic process GO:0006629 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04723
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.71| 11| 20| 153| 166| 1
---------------------------------------------------------------------------
153- 166 (11.76/18.20) QISWktVFLVEyAG
176- 186 (23.94/15.48) QRPW..IFYGD.AG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.91| 10| 15| 117| 126| 2
---------------------------------------------------------------------------
117- 126 (18.28/13.11) QSLRLNPKGK
135- 144 (17.63/12.38) QSLSISDGGK
---------------------------------------------------------------------------
|