<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04722
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MIENRTGPQTIEFLTKRVVALGAVQTGQFLVDCETYVSVPQLGECFRIFQIEFSSRYVFGVAA |
| Length | 63 |
| Position | Head |
| Organism | Habropoda laboriosa |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Apoidea> Apidae>
Habropoda.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | 0.319 |
| Instability index | 48.18 |
| Isoelectric point | 5.11 |
| Molecular weight | 7062.07 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04722
No repeats found
|