| Description | Mediator of RNA polymerase II transcription subunit 4 (Fragment) |
| Sequence | QILATSLYQARQKLASIEKSRKKPVPSEELIKFAHRISASNAVSAPLSWQPGDPRRPYPTDLEMRVGMLGRLCDLPLNGHTPSTLNELHRMTTGGAVPASAPNQFTWHPTGELHMSVGGGGSVALDARGKDASAQEDVEVMSTDSSSSSSSDSQ |
| Length | 154 |
| Position | Middle |
| Organism | Operophtera brumata (winter moth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Geometroidea> Geometridae> Larentiinae> Operophtera. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.514 |
| Instability index | 52.38 |
| Isoelectric point | 6.57 |
| Molecular weight | 16438.19 |
| Publications | PubMed=26227816 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP04703
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 95.16| 20| 23| 76| 95| 1
---------------------------------------------------------------------------
76- 95 (37.71/23.04) PLNGHTPSTLNELHRMTTGG
102- 119 (36.11/21.82) P.NQFTWHPTGELH.MSVGG
126- 143 (21.34/10.53) DARGKDASAQEDVEVMST..
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DARGKDASAQEDVEVMST 2) ILATSL 3) SEELIKFAHRISA 4) YPTDLEMRV | 126 2 27 58 | 143 7 39 66 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab