<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04702
Description |
Uncharacterized protein |
Sequence | MNQAINVDQLNSGLSALRTLRSSVSHVFETLSNGLRADHGEDGKDKFLLELQELLNNVNINLRDLEQTVNGLPMPTAPFNLGNTTYLSQETTQDRQALYTQLVNSYKWTDKIHEYSSFAHTLLSQNSLKRSYINSGSTKRRGKLQSNHNVAPVQVDNVINNIDRSYNDMKITISRPFASNAVVQINLSHVLKAVVAFKGLLMEWVMVKGYGETLDLWTESRHHVFRKVTENAHAAMLHFYSPTLPELAVRSFMTWLHSYVNLFSEPCKRCGCHLHHTSLLPPAWRDFRTLEPFHDECKQ |
Length | 299 |
Position | Tail |
Organism | Operophtera brumata (winter moth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Geometroidea>
Geometridae> Larentiinae> Operophtera.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.403 |
Instability index | 45.32 |
Isoelectric point | 8.30 |
Molecular weight | 34165.33 |
Publications | PubMed=26227816
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP04702
No repeats found
|