<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04684
| Description |
Surfeit 5 |
| Sequence | MQRNLPQNKEALLKSYTTRLKEDIKSMLENFEVRAGESLMKLVSDIKQYLILNDFPSVNEAIAQNSKLFRTKQQECDQKLMSLRDDIAADLYDLEDEYFTSIYK |
| Length | 104 |
| Position | Head |
| Organism | Operophtera brumata (winter moth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Geometroidea>
Geometridae> Larentiinae> Operophtera.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.619 |
| Instability index | 39.17 |
| Isoelectric point | 4.98 |
| Molecular weight | 12231.82 |
| Publications | PubMed=26227816
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04684
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.53| 24| 40| 31| 54| 1
---------------------------------------------------------------------------
31- 54 (40.73/20.93) FEVRAGE...SLMKLVSDIKQYLI.LND
69- 96 (31.80/15.37) FRTKQQEcdqKLMSLRDDIAADLYdLED
---------------------------------------------------------------------------
|