| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MMPGRIGNLPISNENPLGLSWHDSAWIPLLSPSNIMDYFSERSNPFFDRTCNNEVVKMQRLSMDQLQNMTGLEYILLHVQDPILYVIRKQHRSSPSHVIPLADYYIIAGIVYQAPDLASVLNSRLTENNDKSGDKPADGTVNNITIKQEPAEPSGSELTNGTMPHAEIKTEIKQENMKPPPEKKPRVV |
| Length | 188 |
| Position | Head |
| Organism | Operophtera brumata (winter moth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Geometroidea> Geometridae> Larentiinae> Operophtera. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.522 |
| Instability index | 54.27 |
| Isoelectric point | 5.72 |
| Molecular weight | 21148.85 |
| Publications | PubMed=26227816 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP04683
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.63| 18| 19| 132| 149| 1
---------------------------------------------------------------------------
132- 149 (31.57/18.70) SGDKPADGTVNNITIKQE
154- 171 (32.05/19.07) SGSELTNGTMPHAEIKTE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) PEKKPRVV 2) TMPHAEIKTEIKQENMK | 181 162 | 188 178 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab