<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04678
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMSEQFRKVEPYSPKSSPRGARSPVVSRQDSSGTLKTTISLGKNPSIVHSGPFYLMKEPPGECELTGATNLMAYYGLEHSYSKFNGKKLKESLSSFLPNLPGIVDGPGQEDNSTLGSVIAKRPIGGKELLPLSSAQLAGFRLHPGPLPEQYRYVSATPPKRHKSKHKKHKHKDGAPPGQETPLQDSSNPDTYEKKHKKQKRHDDDKERKKRKKEKKRKKQKHSPEHGGLTPSQHPIP |
| Length | 237 |
| Position | Head |
| Organism | Operophtera brumata (winter moth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Geometroidea>
Geometridae> Larentiinae> Operophtera.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.189 |
| Instability index | 58.63 |
| Isoelectric point | 9.94 |
| Molecular weight | 26407.74 |
| Publications | PubMed=26227816
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04678
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 120.04| 25| 48| 160| 184| 1
---------------------------------------------------------------------------
160- 184 (47.53/19.14) KRHKSKHKKHKHKDGAPPGQETPLQ
190- 208 (31.25/10.60) DTYEKKHKKQKRHDD...DKE...R
210- 233 (41.25/15.84) KRKKEK.KRKKQKHSPEHGGLTPSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.63| 23| 38| 86| 111| 2
---------------------------------------------------------------------------
86- 111 (33.61/25.57) GKKLkESLSSflPNLPG..IVDGPGQED
126- 150 (38.02/18.84) GKEL.LPLSS..AQLAGfrLHPGPLPEQ
---------------------------------------------------------------------------
|