<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04666
| Description |
Mediator of RNA polymerase II transcription subunit 20 (Fragment) |
| Sequence | LSRLARWMNAPTSGLDLVERNIILNHSGKKKGVWKLAIKSYRSTLGQIPNLHIPSERTMCTLTMDDNVFVLLDDPVAPTRADVLAAAPPGQEAAYLQGPTHFRTTFLTLRPPGALEQLLAQLKARWVSVRQSSSNVLQRGQSSGQQLMIDGHQYAIGNDWLVRVGNVCLAGGGIKGMVLEAEYLPLPVLHSPGADGTSELLSNLLTSILPNVKDAKTVAVTISDSQWDDVLWEREQGERVDNTTGETTKMASESPEDIYVYGDEDIPEKQPKDWIGIDRDRRSAYLIMGALRSEGIL |
| Length | 297 |
| Position | Head |
| Organism | Termitomyces sp. J132 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Lyophyllaceae> Termitomyces>
unclassified Termitomyces.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.271 |
| Instability index | 53.82 |
| Isoelectric point | 5.46 |
| Molecular weight | 32667.78 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04666
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.38| 13| 20| 78| 90| 1
---------------------------------------------------------------------------
78- 90 (24.92/15.88) PT..RADVLAAAPPG
99- 113 (21.46/12.77) PThfRTTFLTLRPPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 117.26| 38| 116| 1| 46| 2
---------------------------------------------------------------------------
1- 46 (55.43/55.78) LSRL.ARWMNAPTSGLDLVERniilnhsGKKKGvWKLAIKSYRSTLG
119- 157 (61.84/41.03) LAQLkARWVSVRQSSSNVLQR.......GQSSG.QQLMIDGHQYAIG
---------------------------------------------------------------------------
|