<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04662

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMSNILLAPLNELQALAHTLFLSLSPAQTKPPPPPTLTAFLECDKTLSSAVNLAHQHQIKQRRIDALEQEILELEARWREIASALEGGKRELEEMIEEGEERIKAIELAKKAAIPYPELLAYAQSISAFTSAPPNMPDLTLPGQPRLFFPPFPNEEKMRRGRLNAEAPLGLLGETHSVGRPPTVSPKVNDLDQHHGGNVYRQDLRGPQPQFFDLDLDLNPDL
Length221
PositionMiddle
OrganismTermitomyces sp. J132
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Lyophyllaceae> Termitomyces> unclassified Termitomyces.
Aromaticity0.05
Grand average of hydropathy-0.433
Instability index69.00
Isoelectric point5.20
Molecular weight24612.79
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP04662
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     211.16|      52|      52|      87|     138|       1
---------------------------------------------------------------------------
   36-   80 (50.31/21.47)	....LTAFLECDKTLSSAVNLAHQHQIKQRRIDALEQEILELEARWREI...
   87-  138 (82.56/38.99)	GKRELEEMIEEGEERIKAIELAKKAAIPYPELLAYAQSISAFTSAPPNMPDL
  142-  190 (78.29/36.67)	GQPRLFFPPFPNEEKMRRGRLNAEA..PLG.LLGETHSVGRPPTVSPKVNDL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP04662 with Med4 domain of Kingdom Fungi

Unable to open file!