<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04660

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMSLAELTRNCFQSGISSSKWLELCKLFISKQELSRSREVTEVDLSNSVLVLCRFYPGDPDLQGYLEHAIHDGSLSIATFVATLLQAARSSELHSPATLDMLCRVALDAHYSSGVSPIGSVVGYNESTITVLGIVQDALALLRTTHSLPLSHFHQLTASASELVILLLSCASDFSQIPTAQAMVYFADANDLLQNFQLAPDVQRVLETFVLSLSLLIGDDVKVAREAQMLHPIPLALGKGSLHGSGSETDIVTFSLFLHHLVFYRAHDFGVGDNQSSIAVLVALFRWTAWSPVVFYTQLFLSAFTCLSQSASKALIWKAFVVGRLPRLILMFEAVVNAEGITSIDWKRALQAALQTNFRQAELISHCDHAISLARKANTSQDDELLRSFSRDLLQTLVQLDQISMTFAISVDSFISNDELLRLQTEAQDSGVDLEVYLESKFSPDINVDELSSWIDRVVNDDMCHSILSAVILRRFTTLASTYDVDALSHLCKVLYTYEVMLDIMTLHIKVSDLIFRALLFLDQYDCETVGDPQTAVSHLGDVVIFVQHTTARFHLEGELYTSENRTLSSTFLKSTDTAYANDSLSHEDTQAFSVWFKALFDSGSEGIEDSILRSTQPKVLLKISATLFLQAITFHMVQKIDKDTLTNGVSYFMGPLLNWTLVGIIKALIREIIQSRHNITTRIEILQTLLLSPSCPRPVLQLVAPRVCILLGHRKGKINISAHPGVDAASIRRVIGEALGVHTEDVTEAPQASISHISKEDEARQLIQTVLSMARTGKAPSLDVAYCVKIIPPTTFLQLLWSELAIFSSVGEMEISRRVATFVLTMPRSFSTPPLLPIFLHVVVPSIIFAMDHQQTHDHTLKVDLLVTIISSALNAALHLELGIRSVTGEHQFVLGQSSSGMARKLASNLRVRRDHTSRAVLQKLASSQSFAANFAVSINEI
Length942
PositionTail
OrganismTermitomyces sp. J132
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Lyophyllaceae> Termitomyces> unclassified Termitomyces.
Aromaticity0.07
Grand average of hydropathy0.232
Instability index42.70
Isoelectric point5.77
Molecular weight104087.41
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04660
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.01|      17|      26|      17|      33|       1
---------------------------------------------------------------------------
   17-   33 (29.68/21.99)	SSKWLELCKLFISKQEL
   45-   61 (31.33/23.67)	SNSVLVLCRFYPGDPDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.02|      14|     371|     379|     399|       2
---------------------------------------------------------------------------
  379-  398 (18.37/22.67)	SQDDELLRsfsrdlLQTLVQ
  414-  427 (24.65/ 9.16)	ISNDELLR......LQTEAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.26|      21|     370|     255|     287|       3
---------------------------------------------------------------------------
  121-  149 (26.34/ 7.24)	VGYNESTITVLgivqdaLALLRTT........hsLPL
  270-  300 (31.93/42.30)	VGDNQSSIAVL......VALFRWTawspvvfytqLFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     218.08|      57|     326|     500|     556|       7
---------------------------------------------------------------------------
  460-  494 (39.20/17.18)	..DDMC.HSILSAVILRRFTTLaSTYDVD.......ALSHLCKVL.............
  500-  556 (101.29/54.65)	MLDIMTLHIKVSDLIFRALLFL.DQYDCETVGDPQTAVSHLGDVVIFVQHTTARFHLE
  835-  881 (77.59/40.35)	LLPIF.LHVVVPSIIF.AM.......DHQQTHDHTLKVDLL..VTIISSALNAALHLE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04660 with Med5 domain of Kingdom Fungi
Unable to open file!