<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04655
| Description |
Ribosomal protein L16 |
| Sequence | MSGQQRTRTELAPRKFKYRKAFKGKPPIRTGGSTVGTTLEHGQYGLRVLEACRLSAKTLHSCETAIKRAIKPTKGAKCYLRVFPDLPVCVKGNETRMGKGKGPFEYWACRAAVGRVIFEVGGGGIQREMAFAALQHAKPRLPVKSEFIQLNSKPRLGAILLEESQNKLTHHTVATLNPKTIISNMYKLFTNHNITLATKLQQAAAGENYAQISKHPFNQNKQSAIVAQEVDFDLRTLVEPPHLQWIRENEGWSSFGDQEPWPHAAPRPSLEGMPKLYHQLEPKHALQALLNTLIHAYIQLLDVLANQGPVSLSTTPSHPITSKTDQIVSHIELAAFNMHGLCNDLRPRKRKTS |
| Length | 353 |
| Position | Middle |
| Organism | Puccinia sorghi |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.448 |
| Instability index | 39.80 |
| Isoelectric point | 9.85 |
| Molecular weight | 39381.00 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
ribosome GO:0005840 IEA:UniProtKB-KW
|
| GO - Biological Function | rRNA binding GO:0019843 IEA:InterPro
structural constituent of ribosome GO:0003735 IEA:InterPro
transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
translation GO:0006412 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04655
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.62| 14| 19| 250| 264| 1
---------------------------------------------------------------------------
250- 264 (26.15/18.54) EGWSSFGDQ.EPwPHA
271- 285 (24.47/11.55) EGMPKLYHQlEP.KHA
---------------------------------------------------------------------------
|