<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04640
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRASSASFRLGPPSPSSPATGSLKANHPSYISTEHTPQTPTSPPLMSVSAQNYASNFASSQTSPGQATSQPANLSSPPSSVPMSTQASQQPTVGTTNSFPTPASSVNGHFTGATPVDDSEQTEKSFGPEMGATSTTDLNAPMQQTEYRRTDHDRQSEGPSAQTGIRDFGNTSGQDMLNHGDAMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSSHIATGPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKQEPGMAGGLRYMTMWPEEEWQNQKVFGKEIKVADMDSALYNLQMRAMKMEPGTVTNNDYWEDILGHEKQSKHAGSGDGSKKAATPSNGARVPSQANGTPTAAEPERARPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGISKKKRKKDHVSKISTPLPERGGSYGVGMYGIGAR |
| Length | 457 |
| Position | Head |
| Organism | Aspergillus nomius NRRL 13137 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.873 |
| Instability index | 48.24 |
| Isoelectric point | 6.28 |
| Molecular weight | 48938.16 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04640
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.83| 18| 20| 106| 125| 1
---------------------------------------------------------------------------
106- 125 (28.98/25.49) SSvnGHFTGATPVDD....SEQTE
127- 148 (28.85/17.97) SF..GPEMGATSTTDlnapMQQTE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 104.95| 20| 20| 54| 73| 2
---------------------------------------------------------------------------
28- 46 (35.70/17.80) NHPS.YISTEHTPQTPTSPP
54- 73 (36.13/18.10) NYASNFASSQTSPGQATSQP
75- 93 (33.12/15.96) NLSSPPSSVPMST.QASQQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 282.91| 83| 137| 184| 267| 3
---------------------------------------------------------------------------
184- 267 (135.84/67.64) AMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSSHIATgPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKG
324- 406 (147.07/70.04) AMKMEPGTVTNNDYWEDILGHEKQSKHAGSGDGSKKAAT.PSNGARVPSQANGTPTAAEPERARPSRGRKRHYDDNSFVGYGEG
---------------------------------------------------------------------------
|