<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04637

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMDQPQPPTGQPEQPPPPTLTNPRFTLELEFVSSLANPYYLSHLAVTYPHLLGISNASDEGDATKDAADPDAQAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEDTFRRDIIRPQVIEGLAGTGISNEEGDATIEQEGEQDKEEQGKQDAAGNNNSSKT
Length164
PositionMiddle
OrganismAspergillus nomius NRRL 13137
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.09
Grand average of hydropathy-0.716
Instability index49.22
Isoelectric point4.39
Molecular weight18024.50
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP04637
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.60|      10|      74|      52|      63|       1
---------------------------------------------------------------------------
   52-   63 (16.02/17.81)	GISNasDEGDAT
  129-  138 (20.57/14.38)	GISN..EEGDAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     145.44|      41|      80|       6|      46|       2
---------------------------------------------------------------------------
    6-   46 (74.94/39.95)	PPTGQPEQPPPPTLTNPRFTLELEFVSSLANPYYLSHLAVT
   88-  128 (70.50/37.22)	PEYAQFLTHPGATLRALRLLQEDTFRRDIIRPQVIEGLAGT
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP04637 with Med31 domain of Kingdom Fungi

Unable to open file!