<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04637
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MDQPQPPTGQPEQPPPPTLTNPRFTLELEFVSSLANPYYLSHLAVTYPHLLGISNASDEGDATKDAADPDAQAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEDTFRRDIIRPQVIEGLAGTGISNEEGDATIEQEGEQDKEEQGKQDAAGNNNSSKT |
| Length | 164 |
| Position | Middle |
| Organism | Aspergillus nomius NRRL 13137 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.716 |
| Instability index | 49.22 |
| Isoelectric point | 4.39 |
| Molecular weight | 18024.50 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04637
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.60| 10| 74| 52| 63| 1
---------------------------------------------------------------------------
52- 63 (16.02/17.81) GISNasDEGDAT
129- 138 (20.57/14.38) GISN..EEGDAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 145.44| 41| 80| 6| 46| 2
---------------------------------------------------------------------------
6- 46 (74.94/39.95) PPTGQPEQPPPPTLTNPRFTLELEFVSSLANPYYLSHLAVT
88- 128 (70.50/37.22) PEYAQFLTHPGATLRALRLLQEDTFRRDIIRPQVIEGLAGT
---------------------------------------------------------------------------
|