<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04634
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MITHPQSHRNDPTAAPALAKITKNSTAPPAPAGAPAASQASPQQAAAQIPGQQQQGGGDAGQTPGAGGTAADPNLPPAPDSPRTFASRQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERKIRELEKELRSAEEDREQRVRELRKLRKKLENVLGGIEVGIYGDRGVVASSR |
| Length | 174 |
| Position | Middle |
| Organism | Aspergillus nomius NRRL 13137 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.764 |
| Instability index | 63.90 |
| Isoelectric point | 6.76 |
| Molecular weight | 18552.45 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04634
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 145.64| 44| 45| 11| 55| 1
---------------------------------------------------------------------------
11- 55 (70.14/34.17) DPTAAPALAKITKNSTAPPAPaGAPAASQASPQQAAAQIPGQQQQ
59- 102 (75.49/33.88) DAGQTPGAGGTAADPNLPPAP.DSPRTFASRQRELARDLVIKEQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.85| 15| 15| 115| 129| 2
---------------------------------------------------------------------------
115- 129 (24.62/17.30) SSEAEQERKIRELEK
133- 147 (25.23/17.89) SAEEDREQRVRELRK
---------------------------------------------------------------------------
|