Description | Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MITHPQSHRNDPTAAPALAKITKNSTAPPAPAGAPAASQASPQQAAAQIPGQQQQGGGDAGQTPGAGGTAADPNLPPAPDSPRTFASRQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERKIRELEKELRSAEEDREQRVRELRKLRKKLENVLGGIEVGIYGDRGVVASSR |
Length | 174 |
Position | Middle |
Organism | Aspergillus nomius NRRL 13137 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.764 |
Instability index | 63.90 |
Isoelectric point | 6.76 |
Molecular weight | 18552.45 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP04634 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 145.64| 44| 45| 11| 55| 1 --------------------------------------------------------------------------- 11- 55 (70.14/34.17) DPTAAPALAKITKNSTAPPAPaGAPAASQASPQQAAAQIPGQQQQ 59- 102 (75.49/33.88) DAGQTPGAGGTAADPNLPPAP.DSPRTFASRQRELARDLVIKEQQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 49.85| 15| 15| 115| 129| 2 --------------------------------------------------------------------------- 115- 129 (24.62/17.30) SSEAEQERKIRELEK 133- 147 (25.23/17.89) SAEEDREQRVRELRK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ASPQQAAAQ 2) SHRNDPTAAPALAKITKNSTAP | 40 7 | 48 28 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab