| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MATPTHEQLKTLEQSRQRLVQLTRSLASLIGSLNQSDPLPSWSSLQSQASIISNNLLSVSDHLSDNRELLTSLVAYPGPDYPGRTQANTLEQLLRTKLDPRVEDWVARGRKAGASALEDKSAGGGGAGGVVGLGTCGGERGGETQELGVLEDEGSESEDEEEGEDDEMEIVGVRRQSAGAGFEFDIAPAQHHQQKFVEPAVPLEDILRFMTTGAEPGKR |
| Length | 219 |
| Position | Head |
| Organism | Aspergillus nomius NRRL 13137 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.574 |
| Instability index | 51.98 |
| Isoelectric point | 4.62 |
| Molecular weight | 23491.60 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP04627
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.00| 18| 38| 115| 132| 2
---------------------------------------------------------------------------
115- 132 (30.31/15.91) SALEDKSAGGGGAGGVVG
155- 172 (30.69/16.19) SESEDEEEGEDDEMEIVG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DDEMEIVGVRRQ 2) FEFDIA 3) FVEPAVPLEDILRFMTTGA | 165 182 196 | 176 187 214 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab