<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04614
| Description |
Uncharacterized protein |
| Sequence | MFMPVKEASSSSLFQTDVRRRTNLSTATNALRSAAVEAQNDSLGLSSEERLAEMEDELNRIVDRDVETLVEGMEEILELSSVGAVDKLRALQDSLAIELRTETLVRSCTSLMALSHSMKMLWLLGDEANGRKIQDAQTSSLNSEIVQLKSRAAQLIEELKLNPSVETTCDHEMNLDPSPPSSSSADQPN |
| Length | 189 |
| Position | Head |
| Organism | Puccinia striiformis f. sp. tritici PST-78 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.369 |
| Instability index | 66.56 |
| Isoelectric point | 4.54 |
| Molecular weight | 20780.08 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04614
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.22| 14| 32| 67| 80| 1
---------------------------------------------------------------------------
67- 80 (22.68/12.86) ETLVEGMEEILELS
102- 115 (22.54/12.74) ETLVRSCTSLMALS
---------------------------------------------------------------------------
|