Description | Uncharacterized protein |
Sequence | MLLLSINNRSISNLLKPATTRTIQVRTRADLAPRKTKYRKAFKGSVPVRTGGSTLATTLEHGQFGLRVLEPCRISAKTLQSCETAIKRAIKTTKGAKCYLRVFPDLPVCVKGNEVRMGKGKGPFEYWACRAVVGRVLFEVGGGGIAKEIAYAALQHAKPRLPLLIDRLDEHHQPFDPLKQKQILNDQDQVPEDLDLRTLSIPPNLEWIKENGGWNSFGDLNPWDSRNQGESLLGMPKLYDPKIDRKQALKNLLNTLIYSYMNLLQVLSTKGPVTQSTTTTSTTTTETDQIVSHIELTAFNFLGLSNELRPAQATQTLKLMLVNQAHLKRQKAKDVILTCENLRNQLAALKSSHDYQDQNTSIIDPIRSDPGEDGGDHNGGTYDYELLNSYINNS |
Length | 394 |
Position | Middle |
Organism | Puccinia striiformis f. sp. tritici PST-78 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.463 |
Instability index | 35.44 |
Isoelectric point | 9.27 |
Molecular weight | 43948.74 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro ribosome GO:0005840 IEA:UniProtKB-KW |
GO - Biological Function | rRNA binding GO:0019843 IEA:InterPro structural constituent of ribosome GO:0003735 IEA:InterPro transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro translation GO:0006412 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04612 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 120.01| 34| 166| 187| 223| 1 --------------------------------------------------------------------------- 187- 223 (61.88/45.37) QDQVPEDLD.LRTlsiPPNLEWIKENGGWNSFGDLNPW 356- 390 (58.13/35.42) QDQNTSIIDpIRS...DPGEDGGDHNGGTYDYELLNSY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.07| 22| 291| 3| 24| 2 --------------------------------------------------------------------------- 3- 24 (36.92/26.69) LLSINNRSISNLLKPA.TTRTIQ 296- 318 (33.15/23.22) LTAFNFLGLSNELRPAqATQTLK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IIDPIRS 2) RKAFK 3) TYDYELLNSYINNS | 362 39 381 | 368 43 394 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab