<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04608

Description Mediator of RNA polymerase II transcription subunit 11
SequenceMSSPGSSSSSDSSASSSSNPFDPSTLTQLQQQQHPRTTTTDLEQAINNLDPTTIEANSQATTTFTLSGFTNNNSNPMQSQNTDLTSIINTQTTNGPSQPISKTAHHVITAPSRGWMSQRKGRAVHIEDDPQSSLRNEIEGEFEDLDQSSEQHLYTSSHSSQRIIELGIVEEQLSQLLNLASDVLGSLGPPLDEDESTTTAIKSFSSSINEYFELLNKIQSRLRSSMSYLRVARISTRSLFEPAHVTIPNCPVGLGDLNLTATHSLSSINQTAPVGTTDPTFNFSAPNHHQSAGKGIQESSPTLSLGSLVAERNAWKDLVDSLELIKAQQRSNPV
Length334
PositionHead
OrganismPuccinia striiformis f. sp. tritici PST-78
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
Aromaticity0.04
Grand average of hydropathy-0.575
Instability index65.81
Isoelectric point4.99
Molecular weight36163.09
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364147
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP04608
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      78.01|      19|      21|      70|      88|       1
---------------------------------------------------------------------------
   36-   54 (27.80/11.79)	RTTTTDLEQAI....NNLDPTTI
   55-   77 (23.77/ 9.19)	EANSQATTTFTlsgfTNNNSNPM
   78-  100 (26.45/10.92)	QSQNTDLTSIIntqtTNGPSQPI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.78|      13|      19|     118|     133|       2
---------------------------------------------------------------------------
  118-  133 (18.88/22.20)	QRKGravHIEDDPQSS
  137-  149 (20.89/13.95)	EIEG...EFEDLDQSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.08|      14|      16|     206|     221|       3
---------------------------------------------------------------------------
  206-  221 (15.48/18.82)	SSINeYFElLNKIQSR
  224-  237 (23.60/15.35)	SSMS.YLR.VARISTR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.73|      17|      21|     251|     270|       4
---------------------------------------------------------------------------
  251-  267 (29.86/15.98)	PVGLGD..LNLTATHSLSS
  273-  291 (28.87/ 9.03)	PVGTTDptFNFSAPNHHQS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP04608 with Med11 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MSSPGSSSSSDSSASSSSNPFDPSTLTQLQQQQHPRTTTTDLEQAINNLDPTTIEANSQATTTFTLSGFTNNNSNPMQSQNTDLTSIINTQTTNGPSQPISKTAHHVITAPSRGWMSQRKGRAVHIEDDPQSSLRNEIEGEFEDLDQSSEQHLY
1
154

Molecular Recognition Features

MoRF SequenceStartStop
1) YLRVARI
228
234