Description | Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
Sequence | NTATPPQRCNAASSLPQRAAAAAALTLPYIGTLRFRVSRRRRGGTTTSDLNMSLSASIASGTTLPTPAHSVNGGYSQPDVLMSDEPPHKRKRSLDDVGDRDQKKMHLEDRKLGIEDLHLDVGDKYLLCQTLHPQPLPRMSEDLFEMFGLTDLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEEEPSDFVAMVQVPELEWNVHQAKGREVGDGLSEAILSSLGRALTMSKGPIPKAIWDTSVLGDLAPANADASKPVSAKPTAPNTPLASTPNAMSRSKSLLPPGHDPTRPRRNIKKRSYGDSSFEGYGEGFPDDDAGLDTGYSTGEGEAGQKRRKKSSGNSPPYPTIRQQSYGPGMVGA |
Length | 369 |
Position | Head |
Organism | Tolypocladium ophioglossoides CBS 100239 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.724 |
Instability index | 54.75 |
Isoelectric point | 9.21 |
Molecular weight | 39842.34 |
Publications | PubMed=26215153 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04594 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.14| 16| 23| 227| 244| 1 --------------------------------------------------------------------------- 227- 242 (26.11/16.37) ILSSLGRALTMSKGPI 251- 266 (26.03/ 9.57) VLGDLAPANADASKPV --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.68| 22| 23| 96| 117| 2 --------------------------------------------------------------------------- 96- 117 (38.95/31.30) DVGDRDQKKMHLEDRKLG..IEDL 120- 143 (36.73/29.05) DVGDKYLLCQTLHPQPLPrmSEDL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.86| 11| 29| 43| 53| 3 --------------------------------------------------------------------------- 43- 53 (20.31/10.48) GGTTTSDLNMS 73- 83 (21.55/11.49) GGYSQPDVLMS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.35| 13| 23| 185| 197| 4 --------------------------------------------------------------------------- 185- 197 (22.15/16.15) FDVQKKKEEEPSD 209- 221 (24.21/18.34) WNVHQAKGREVGD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 33.77| 10| 35| 19| 28| 5 --------------------------------------------------------------------------- 19- 28 (16.25/ 9.85) AAAAAALTLP 56- 65 (17.52/11.15) ASIASGTTLP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AGQKRRKKSS 2) ALTLPYI 3) SPPYPTIRQQSYGPGMVG | 339 24 351 | 348 30 368 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab