<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04594
| Description |
Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
| Sequence | NTATPPQRCNAASSLPQRAAAAAALTLPYIGTLRFRVSRRRRGGTTTSDLNMSLSASIASGTTLPTPAHSVNGGYSQPDVLMSDEPPHKRKRSLDDVGDRDQKKMHLEDRKLGIEDLHLDVGDKYLLCQTLHPQPLPRMSEDLFEMFGLTDLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEEEPSDFVAMVQVPELEWNVHQAKGREVGDGLSEAILSSLGRALTMSKGPIPKAIWDTSVLGDLAPANADASKPVSAKPTAPNTPLASTPNAMSRSKSLLPPGHDPTRPRRNIKKRSYGDSSFEGYGEGFPDDDAGLDTGYSTGEGEAGQKRRKKSSGNSPPYPTIRQQSYGPGMVGA |
| Length | 369 |
| Position | Head |
| Organism | Tolypocladium ophioglossoides CBS 100239 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.724 |
| Instability index | 54.75 |
| Isoelectric point | 9.21 |
| Molecular weight | 39842.34 |
| Publications | PubMed=26215153
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04594
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.14| 16| 23| 227| 244| 1
---------------------------------------------------------------------------
227- 242 (26.11/16.37) ILSSLGRALTMSKGPI
251- 266 (26.03/ 9.57) VLGDLAPANADASKPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.68| 22| 23| 96| 117| 2
---------------------------------------------------------------------------
96- 117 (38.95/31.30) DVGDRDQKKMHLEDRKLG..IEDL
120- 143 (36.73/29.05) DVGDKYLLCQTLHPQPLPrmSEDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.86| 11| 29| 43| 53| 3
---------------------------------------------------------------------------
43- 53 (20.31/10.48) GGTTTSDLNMS
73- 83 (21.55/11.49) GGYSQPDVLMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.35| 13| 23| 185| 197| 4
---------------------------------------------------------------------------
185- 197 (22.15/16.15) FDVQKKKEEEPSD
209- 221 (24.21/18.34) WNVHQAKGREVGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.77| 10| 35| 19| 28| 5
---------------------------------------------------------------------------
19- 28 (16.25/ 9.85) AAAAAALTLP
56- 65 (17.52/11.15) ASIASGTTLP
---------------------------------------------------------------------------
|