Description | Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MGDRLTQLQDAVDQLAQQFVACLHFVHRRHDLEALGPSDKIRDVKQEPQQREVDPLPADEFQAGLKELSRDLIVKEQQIEYLISSLPGLDNSEKDQERNIKDLEEDLKAAEAQRQEALKERDQILSELDGVIRSIRRP |
Length | 138 |
Position | Middle |
Organism | Tolypocladium ophioglossoides CBS 100239 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.825 |
Instability index | 61.88 |
Isoelectric point | 4.78 |
Molecular weight | 15906.62 |
Publications | PubMed=26215153 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi transcription corepressor activity GO:0003714 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP04592 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.65| 14| 27| 42| 57| 1 --------------------------------------------------------------------------- 42- 57 (22.54/17.27) RD..VKQepQQRE..VDPLP 70- 87 (16.10/ 6.09) RDliVKE..QQIEylISSLP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EALKERDQILSELDGVIRSIRRP 2) PSDKIRDVKQEPQQREVDPLPADEFQAGLKELSRDLIVKEQQIEYLISSLPGLDNSEKDQERNIKDLEEDLKAAEAQR | 116 37 | 138 114 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab