Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MADQEPQETLSLASTFPNPPPFWKDFTPDRVARIEDLRRARAEDTNDGAGADAALVRLPDLPEELANLQPPPEPADGRWRVFGDQYMLDDKLPTLEEQGITNLPATGPSPSKDAKHYNRALELKKLAKSLLLNFLELAGTLSRSPAAAAAKTQDLRTLFINVHHILNEYRPHQARESAIELMQDHLDRTRAETVAIRTQVDKARRVLEGLGSLGLAPSWPAGADADARLGKGGAEGTRLAGERDAEVWTATDAAFA |
Length | 256 |
Position | Middle |
Organism | Tolypocladium ophioglossoides CBS 100239 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.540 |
Instability index | 49.19 |
Isoelectric point | 5.16 |
Molecular weight | 27997.04 |
Publications | PubMed=26215153 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04591 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 66.43| 18| 54| 6| 26| 1 --------------------------------------------------------------------------- 6- 26 (33.79/22.97) PQEtlsLASTFPNPPP...FWKDF 62- 82 (32.64/15.55) PEE...LANLQPPPEPadgRWRVF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWKDFTPDRVARIEDLRRARA 2) RWRVFGDQY | 22 78 | 42 86 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab