Description | Uncharacterized protein |
Sequence | MDRVSQLQELLDKTVQDFAKALGRLQFETPPVAVDLNTPVTFLSEEQLRSSQQNKTAFIQETAKDMILSVKAMDYLIDNLPAINMTQDDQNARLRDLNEESKAATIELQEAVDEAAEILREIRDTRDFLARQKSLVTDDDGAGS |
Length | 144 |
Position | Middle |
Organism | Spizellomyces punctatus (strain DAOM BR117) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota> Chytridiomycota incertae sedis> Chytridiomycetes> Spizellomycetales> Spizellomycetaceae> Spizellomyces. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.506 |
Instability index | 54.19 |
Isoelectric point | 4.36 |
Molecular weight | 16199.92 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP04578 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) DQNARLRDLNE 2) EILREIRDTRDFLARQKSLVT 3) NLPAI | 89 117 79 | 99 137 83 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab