<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04573
| Description |
Uncharacterized protein |
| Sequence | MAMASRSMELELAPLVAPRGPSTVPSAGGSAALSPLGGNLPMSATALPPAQPALAAESTETLLAARADLADLAASATAIRSAASTVVELLAMPTQDTGQASVATKAGEDGEDGAAVGGSGRLQSGQIAARRPAALRKAHDALVDALGRLRSLRNAVAALPLALTPAAAASALDAAPPALDALLADMVTAASAASRARSRAAAVGYTDAARKLFPGLLEPKTSRKRPRVYAITPASHPSKRRKPLGSGSPSRSGLPAKLVGVMASAAPSFRIVSWKYHPLELSSRLARLTLELPHVFQVCITFSGAVGLAESDTLIPALISLSRPRHAPPLAPGACDPVLDAIEVHVRAAHLYFVSAYPAAPLPPLLVWLHSYARLYSTPCTVCGALVRIARGDAGGPMPPVFRPFRVDRARQGRLLAPRLLTVATTGSPIDPRLALAEGAYHNECFTRETLIRQQEQQPSTLATTSASPPPTPQ |
| Length | 474 |
| Position | Tail |
| Organism | Thecamonas trahens ATCC 50062 |
| Kingdom | Apusozoa |
| Lineage | Eukaryota> Apusozoa> Apusomonadidae> Thecamonas.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | 0.088 |
| Instability index | 56.62 |
| Isoelectric point | 10.05 |
| Molecular weight | 48956.86 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04573
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 136.49| 29| 31| 194| 222| 1
---------------------------------------------------------------------------
18- 46 (29.11/ 7.83) ..PRGPSTVPSAGgS...AALSPLGGNL...pMSATA
48- 78 (35.34/11.14) PPA.QPALAAEST.EtllAARADLADLA....ASATA
162- 192 (27.96/ 7.21) ..ALTPAAAASAL.D...AAPPALDALLadmvTAASA
194- 222 (44.08/15.80) SRARSRAAAVGYT.D...AARKLFPGLL....EPKTS
---------------------------------------------------------------------------
|